PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02328.1.g00030.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 498aa    MW: 54970 Da    PI: 10.2323
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02328.1.g00030.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.1e-18176229356
                                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   k++++++eq+e Le  F++++++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  Zpz_sc02328.1.g00030.1.am.mk 176 KKRRLSDEQVEMLELSFREEQKLETGRKVHLAAELGLDPKQVAVWFQNRRARHK 229
                                   45589***********************************************99 PP

2HD-ZIP_I/II114.18.7e-37176266292
                   HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLek 82 
                                   kkrrls+eqv++LE sF+ee+kLe+ rKv+la eLgl+p+qvavWFqnrRAR+k+k lE+++++Lk+a+da   ++++Le+
  Zpz_sc02328.1.g00030.1.am.mk 176 KKRRLSDEQVEMLELSFREEQKLETGRKVHLAAELGLDPKQVAVWFQNRRARHKSKLLEEEFAKLKQAHDAAILHKCHLEN 256
                                   9******************************************************************************** PP

                   HD-ZIP_I/II  83 eveeLreelk 92 
                                   ev +L+e+l 
  Zpz_sc02328.1.g00030.1.am.mk 257 EVLRLKERLV 266
                                   ******9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.342171231IPR001356Homeobox domain
SMARTSM003892.4E-17174235IPR001356Homeobox domain
SuperFamilySSF466892.8E-16174237IPR009057Homeodomain-like
CDDcd000868.95E-15176231No hitNo description
PfamPF000461.1E-15176229IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.6E-18176229IPR009057Homeodomain-like
PRINTSPR000314.1E-5202211IPR000047Helix-turn-helix motif
PROSITE patternPS000270206229IPR017970Homeobox, conserved site
PRINTSPR000314.1E-5211227IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MHGPARKAIT YPATRPASAT GVGRAYLSYI YILLLGLSRD EHSALLNTQL GALWSSLSLF  60
QFLLSSHIDS VSHSAPSLSP ASSRSPRTWQ GDRESEKGVV AADPTGGRGG KAWSNTTSCS  120
TSSYLPPSLT WTPPSWRPTV RVAQGEERPR ARRRRRRVAR CSGAEAGGEV DAGDPKKRRL  180
SDEQVEMLEL SFREEQKLET GRKVHLAAEL GLDPKQVAVW FQNRRARHKS KLLEEEFAKL  240
KQAHDAAILH KCHLENEVLR LKERLVVAEE ELARLRSAGS HAVSGGDVMG RIVSSGSPSS  300
SFSTGTCHQQ AGVGSVVDQL GDDDLIYVPD VADYAYADSS VVEWFSLYGL IGHLCYQRAG  360
IGTELAAERC HSPSNTRVRA HGDLAISGYR ARPGRSTHLI WERRRTIERS SRWNSAQFHH  420
DGRRGHTRSC CNGISRPSRM RRDGRHTCGR PAGKHARRGI LGQRKACAPC DFALRPEPVP  480
DHCLNKIARA RCPHQMIG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147156RPRARRRRRR
2147157RPRARRRRRRV
3151159RRRRRRVAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.13e-38homeobox protein 40